RegulonDB RegulonDB 10.9: Gene Form
   

insK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glyS insJK insK insJ sokA TSS_4166 (cluster) TSS_4166 (cluster) TSS_4165 TSS_4165 TSS_4164 (cluster) TSS_4164 (cluster) TSS_4163 TSS_4163 TSS_4162 TSS_4162 insKp insKp hokAp6 hokAp6

Gene      
Name: insK    Texpresso search in the literature
Synonym(s): ECK3546, G7777, b3558, dinS, t150, yi5B
Genome position(nucleotides): 3721198 --> 3722049 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.84
External database links:  
ASAP:
ABE-0011622
ECHOBASE:
EB4760
ECOLIHUB:
insK
ECOO157CYC:
Z1573
ECOO157CYC:
Z1957
OU-MICROARRAY:
b3558
STRING:
511145.b3558
COLOMBOS: insK


Product      
Name: IS150 conserved protein InsB
Synonym(s): DinS, InsK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.477
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
117 -> 279 KATRPNEKWVTDVTEFAVNGRKLYLSPVIDLFNNEVISYSLSERPVMNMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILKEHGIKQSMSRKGNCLDNAVVECFFGTLKSECFYLDEFSNISELKDAVTEYIEYYNSRRISLKLKGLTPIEYRNQTY
119 -> 217 TRPNEKWVTDVTEFAVNGRKLYLSPVIDLFNNEVISYSLSERPVMNMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILKEHGIKQSMSRKGNC
224 -> 278 ECFFGTLKSECFYLDEFSNISELKDAVTEYIEYYNSRRISLKLKGLTPIEYRNQT
43 -> 96 VKKRISEIYHENRGRYGYRRVTLSLHREGKQINHKAVQRLMGTLSLKAAIKVKR
213 -> 213 R

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0032196 - transposition
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7777-MONOMER
ECOLIWIKI:
b3558
ECOO157CYC:
Z1957-MONOMER
ECOO157CYC:
Z1573-MONOMER
INTERPRO:
IPR038965
INTERPRO:
IPR036397
INTERPRO:
IPR025948
INTERPRO:
IPR001584
INTERPRO:
IPR012337
MODBASE:
P19769
PANTHER:
PTHR42648
PFAM:
PF13333
PFAM:
PF00665
PFAM:
PF13276
PRIDE:
P19769
PROSITE:
PS50994
REFSEQ:
NP_418015
SMR:
P19769
UNIPROT:
P19769


Operon      
Name: insK         
Operon arrangement:
Transcription unit        Promoter
insK


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insJp4 3720594 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter hokAp6 3720810 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4162 3721864 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4163 3722550 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4164 (cluster) 3723367 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4165 3723961 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4166 (cluster) 3724383 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB