RegulonDB RegulonDB 10.9: Gene Form
   

dcuR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcuS dcuB dcuR yjdI NarL NarL CRP DcuR DcuR NarL CRP FNR NarL NarL NarL NarL NarL FNR FNR FNR TSS_4927 TSS_4927 dcuSp dcuSp dcuRp dcuRp dcuBp2 dcuBp2 TSS_4925 TSS_4925 TSS_4924 TSS_4924 dcuBp dcuBp TSS_4923 (cluster) TSS_4923 (cluster)

Gene      
Name: dcuR    Texpresso search in the literature
Synonym(s): ECK4117, G7826, b4124, yjdG
Genome position(nucleotides): 4349315 <-- 4350034 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.31
External database links:  
ASAP:
ABE-0013507
ECHOBASE:
EB2357
ECOLIHUB:
dcuR
OU-MICROARRAY:
b4124
STRING:
511145.b4124
COLOMBOS: dcuR


Product      
Name: DNA-binding transcriptional activator DcuR
Synonym(s): DcuR, DcuR response regulator, YjdG
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 27.488
Isoelectric point: 6.3
Motif(s):
 
Type Positions Sequence
3 -> 121 NVLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFNSDTPIDLILLDIYMQKENGLDLLPVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWR
4 -> 117 VLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFNSDTPIDLILLDIYMQKENGLDLLPVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYLIKPFQASRFEEAL
181 -> 200 TDELANEVNISRVSCRKYLI
1 -> 121 MINVLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFNSDTPIDLILLDIYMQKENGLDLLPVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0042803 - protein homodimerization activity
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Evidence: [GEA] Gene expression analysis
[IFC] Inferred by functional complementation
Reference(s): [1] Zientz E., et al., 1998
External database links:  
DIP:
DIP-48032N
ECOCYC:
DCUR-MONOMER
ECOLIWIKI:
b4124
INTERPRO:
IPR001789
INTERPRO:
IPR024187
INTERPRO:
IPR011006
MODBASE:
P0AD01
PANTHER:
PTHR45526
PFAM:
PF00072
PRIDE:
P0AD01
PRODB:
PRO_000022415
PROSITE:
PS50110
REFSEQ:
NP_418548
SMART:
SM00448
SMR:
P0AD01
UNIPROT:
P0AD01


Operon      
Name: dcuSR         
Operon arrangement:
Transcription unit        Promoter
dcuR
dcuSR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4923 (cluster) 4347981 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4924 4348786 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4925 4348841 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4927 4351813 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Zientz E., Bongaerts J., Unden G., 1998, Fumarate regulation of gene expression in Escherichia coli by the DcuSR (dcuSR genes) two-component regulatory system., J Bacteriol 180(20):5421-5

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB