RegulonDB RegulonDB 10.9: Gene Form
   

fxsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aspA yjeH fxsA DcuR NarL CRP NarL DcuR NarL FNR anti-anti-terminator anti-terminator fxsAp fxsAp aspAp aspAp TSS_4948 TSS_4948 TSS_4947 TSS_4947 TSS_4946 TSS_4946 TSS_4945 TSS_4945 TSS_4944 TSS_4944 dcuAp2 dcuAp2

Gene      
Name: fxsA    Texpresso search in the literature
Synonym(s): ECK4134, G7832, b4140, yjeG
Genome position(nucleotides): 4368664 --> 4369140 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.38
Reference(s): [1] Wang WF., et al., 1999
External database links:  
ASAP:
ABE-0013557
ECHOBASE:
EB2284
ECOLIHUB:
fxsA
OU-MICROARRAY:
b4140
STRING:
511145.b4140
COLOMBOS: fxsA


Product      
Name: protein FxsA
Synonym(s): FxsA, YjeG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.692
Isoelectric point: 8.975
Motif(s):
 
Type Positions Sequence
17 -> 37 ISIFIQVAHVLGVLLTLVLVI
8 -> 109 AIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQKMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLT
79 -> 99 IIAGLLLLLPGFFTDFLGLLL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.2 - plasmid related
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031226 - intrinsic component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
[IMP] Inferred from mutant phenotype
Reference(s): [1] Wang WF., et al., 1999
[2] Wang WF., et al., 1999
External database links:  
ECOCYC:
G7832-MONOMER
ECOLIWIKI:
b4140
INTERPRO:
IPR007313
PANTHER:
PTHR35335
PFAM:
PF04186
PRIDE:
P37147
REFSEQ:
NP_418564
UNIPROT:
P37147


Operon      
Name: fxsA         
Operon arrangement:
Transcription unit        Promoter
fxsA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4944 4367788 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4945 4367803 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4946 4368190 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4947 4368393 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4948 4368431 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Wang WF., Cheng X., Molineux IJ., 1999, Isolation and identification of fxsA, an Escherichia coli gene that can suppress F exclusion of bacteriophage T7., J Mol Biol 292(3):485-99

 [2] Wang WF., Margolin W., Molineux IJ., 1999, Increased synthesis of an Escherichia coli membrane protein suppresses F exclusion of bacteriophage T7., J Mol Biol 292(3):501-12

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB