RegulonDB RegulonDB 11.0: Gene Form
   

yjfL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjfK yjfM yjfL

Gene      
Name: yjfL    Texpresso search in the literature
Synonym(s): ECK4180, G7849, b4184
Genome position(nucleotides): 4411979 --> 4412377
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.61
External database links:  
ASAP:
ABE-0013694
ECHOBASE:
EB2380
ECOLIHUB:
yjfL
OU-MICROARRAY:
b4184
STRING:
511145.b4184
COLOMBOS: yjfL


Product      
Name: DUF350 domain-containing inner membrane protein YjfL
Synonym(s): YjfL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.224
Isoelectric point: 7.6
Motif(s):
 
Type Positions Sequence Comment
7 -> 27 LLAFSAYFFIGVAMVIIFLFI UniProt: Helical.
13 -> 65 YFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVIPLSSA
47 -> 67 ASLAFSGTLLGYVIPLSSAAI UniProt: Helical.
72 -> 92 IPDYFAWGGIALVIQLLVFAG UniProt: Helical.
78 -> 130 WGGIALVIQLLVFAGVRLYMPALSEKIINHNTAAGMFMGTAALAGGIFNAACM

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0AF80
ECOCYC:
G7849-MONOMER
ECOLIWIKI:
b4184
INTERPRO:
IPR007140
PFAM:
PF03994
PRIDE:
P0AF80
REFSEQ:
NP_418605
UNIPROT:
P0AF80


Operon      
Name: yjfKLMC         
Operon arrangement:
Transcription unit        Promoter
yjfKLMC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB