RegulonDB RegulonDB 10.10: Gene Form
   

yjfN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aidB bsmA yjfN terminator yjfPp4 yjfPp4 TSS_5053 TSS_5053

Gene      
Name: yjfN    Texpresso search in the literature
Synonym(s): ECK4184, G7851, b4188
Genome position(nucleotides): 4416017 <-- 4416292 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.09
External database links:  
ASAP:
ABE-0013704
ECHOBASE:
EB2412
ECOLIHUB:
yjfN
OU-MICROARRAY:
b4188
STRING:
511145.b4188
COLOMBOS: yjfN


Product      
Name: protease activator YjfN
Synonym(s): YjfN
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 9.949
Isoelectric point: 3.961
Motif(s):
 
Type Positions Sequence
1 -> 21 MKQLLASPSLQLVTYPASATA
91 -> 91 A
22 -> 91 QSAEFASADCVTGLNEIGQISVSNISGDPQDVERIVALKADEQGASWYRIITMYEDQQPDNWRVQAILYA
35 -> 90 LNEIGQISVSNISGDPQDVERIVALKADEQGASWYRIITMYEDQQPDNWRVQAILY
83 -> 83 W

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
molecular_function GO:0061133 - endopeptidase activator activity
biological_process GO:0010950 - positive regulation of endopeptidase activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Butland G., et al., 2005
[2] Chang DE., et al., 2002
[3] Nobre LS., et al., 2009
[4] Song I., et al., 2018
External database links:  
DIP:
DIP-48101N
ECOCYC:
G7851-MONOMER
ECOLIWIKI:
b4188
INTERPRO:
IPR010854
INTERPRO:
IPR025543
INTERPRO:
IPR036275
PFAM:
PF07338
PRIDE:
P0AF82
REFSEQ:
NP_418609
UNIPROT:
P0AF82


Operon      
Name: yjfN         
Operon arrangement:
Transcription unit        Promoter
yjfN


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5053 4415541 forward nd [RS-EPT-CBR] [5]
  promoter yjfPp4 4416756 forward nd [ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Butland G., Peregrin-Alvarez JM., Li J., Yang W., Yang X., Canadien V., Starostine A., Richards D., Beattie B., Krogan N., Davey M., Parkinson J., Greenblatt J., Emili A., 2005, Interaction network containing conserved and essential protein complexes in Escherichia coli., Nature 433(7025):531-7

 [2] Chang DE., Smalley DJ., Conway T., 2002, Gene expression profiling of Escherichia coli growth transitions: an expanded stringent response model., Mol Microbiol 45(2):289-306

 [3] Nobre LS., Al-Shahrour F., Dopazo J., Saraiva LM., 2009, Exploring the antimicrobial action of a carbon monoxide-releasing compound through whole-genome transcription profiling of Escherichia coli., Microbiology 155(Pt 3):813-24

 [4] Song I., Eom G., Kim S., 2018, A Small Periplasmic Protein with a Hydrophobic C-Terminal Residue Enhances DegP Proteolysis as a Suicide Activator., J Bacteriol 200(3)

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB