RegulonDB RegulonDB 10.9: Gene Form
   

ulaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaG ulaR yjfP bsmA ulaRp5 ulaRp5 TSS_5054 TSS_5054 yjfPp5 yjfPp5 bsmAp bsmAp yjfPp4 yjfPp4

Gene      
Name: ulaR    Texpresso search in the literature
Synonym(s): ECK4187, G7854, b4191, yjfQ
Genome position(nucleotides): 4417698 <-- 4418453 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.66
Reference(s): [1] Campos E., et al., 2002
External database links:  
ASAP:
ABE-0013713
ECHOBASE:
EB2384
ECOLIHUB:
ulaR
OU-MICROARRAY:
b4191
STRING:
511145.b4191
COLOMBOS: ulaR


Product      
Name: DNA-binding transcriptional repressor UlaR
Synonym(s): UlaR, YjfQ
Sequence: Get amino acid sequence Fasta Format
Regulator Family: DeoR
Cellular location: cytosol
Molecular weight: 27.602
Isoelectric point: 8.668
Motif(s):
 
Type Positions Sequence
76 -> 230 NHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIMGGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGLTAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKIGERAGMLFSRADQIDMLITG
3 -> 58 EAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEA
6 -> 62 RHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQ
20 -> 39 VTVEKVVERLGISPATARRD
1 -> 62 MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAITQQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0031418 - L-ascorbic acid binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
Reference(s): [1] Campos E., et al., 2002
External database links:  
DIP:
DIP-47874N
ECOCYC:
G7854-MONOMER
ECOLIWIKI:
b4191
INTERPRO:
IPR018356
INTERPRO:
IPR023711
INTERPRO:
IPR036388
INTERPRO:
IPR014036
INTERPRO:
IPR036390
INTERPRO:
IPR037171
INTERPRO:
IPR001034
MODBASE:
P0A9W0
PFAM:
PF08220
PFAM:
PF00455
PRIDE:
P0A9W0
PRINTS:
PR00037
PRODB:
PRO_000024181
PROSITE:
PS00894
PROSITE:
PS51000
REFSEQ:
NP_418612
SMART:
SM00420
UNIPROT:
P0A9W0


Operon      
Name: ulaR         
Operon arrangement:
Transcription unit        Promoter
ulaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjfPp4 4416756 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yjfPp5 4416935 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_5054 4416936 forward nd [RS-EPT-CBR] [3]
  promoter ulaRp5 4418562 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Campos E., Aguilar J., Baldoma L., Badia J., 2002, The gene yjfQ encodes the repressor of the yjfR-X regulon (ula), which is involved in L-ascorbate metabolism in Escherichia coli., J Bacteriol 184(21):6065-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB