RegulonDB RegulonDB 10.9: Gene Form
   

ulaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaE ulaD ulaC

Gene      
Name: ulaD    Texpresso search in the literature
Synonym(s): ECK4192, G7858, b4196, sgaH, yjfV
Genome position(nucleotides): 4422186 --> 4422836 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.14
Reference(s): [1] Yew WS., et al., 2002
External database links:  
ASAP:
ABE-0013729
ECHOBASE:
EB2389
ECOLIHUB:
ulaD
OU-MICROARRAY:
b4196
STRING:
511145.b4196
COLOMBOS: ulaD


Product      
Name: 3-keto-L-gulonate-6-phosphate decarboxylase UlaD
Synonym(s): SgaH, UlaD, YjfV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.578
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
64 -> 64 K
112 -> 112 E
139 -> 139 R
67 -> 67 D
5 -> 206 MLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016831 - carboxy-lyase activity
GO:0004590 - orotidine-5'-phosphate decarboxylase activity
GO:0000287 - magnesium ion binding
GO:0033982 - 3-dehydro-L-gulonate-6-phosphate decarboxylase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic process
GO:0019854 - L-ascorbic acid catabolic process
External database links:  
DIP:
DIP-10869N
ECOCYC:
G7858-MONOMER
ECOLIWIKI:
B4196
INTERPRO:
IPR011060
INTERPRO:
IPR013785
INTERPRO:
IPR023942
INTERPRO:
IPR041710
INTERPRO:
IPR001754
MODBASE:
P39304
PDB:
1XBV
PDB:
1XBX
PDB:
1XBY
PDB:
1XBZ
PDB:
1SO6
PDB:
1SO5
PDB:
1SO4
PDB:
1SO3
PDB:
1Q6R
PDB:
1Q6Q
PDB:
1Q6O
PDB:
1Q6L
PDB:
1KW1
PDB:
1KV8
PFAM:
PF00215
PRIDE:
P39304
PRODB:
PRO_000024178
REFSEQ:
NP_418617
SMART:
SM00934
SMR:
P39304
UNIPROT:
P39304


Operon      
Name: ulaABCDEF         
Operon arrangement:
Transcription unit        Promoter
ulaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IHF, UlaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Yew WS., Gerlt JA., 2002, Utilization of L-ascorbate by Escherichia coli K-12: assignments of functions to products of the yjf-sga and yia-sgb operons., J Bacteriol 184(1):302-6


RegulonDB