RegulonDB RegulonDB 10.9: Gene Form
   

ulaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaE ulaF ulaD yjfY

Gene      
Name: ulaE    Texpresso search in the literature
Synonym(s): ECK4193, G7859, b4197, sgaU, yjfW
Genome position(nucleotides): 4422846 --> 4423700 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.73
Reference(s): [1] Yew WS., et al., 2002
External database links:  
ASAP:
ABE-0013732
ECHOBASE:
EB2390
ECOLIHUB:
ulaE
OU-MICROARRAY:
b4197
STRING:
511145.b4197
COLOMBOS: ulaE


Product      
Name: L-ribulose-5-phosphate 3-epimerase UlaE
Synonym(s): SgaU, UlaE, YjfW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.007
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
25 -> 272 LQLAKTLGFDFVEMSVDETDDRLSRLNWSREQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMSSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0016861 - intramolecular oxidoreductase activity, interconverting aldoses and ketoses
GO:0034015 - L-ribulose-5-phosphate 3-epimerase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0019852 - L-ascorbic acid metabolic process
GO:0019854 - L-ascorbic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7859-MONOMER
ECOLIWIKI:
B4197
INTERPRO:
IPR023492
INTERPRO:
IPR013022
INTERPRO:
IPR036237
INTERPRO:
IPR004560
MODBASE:
P39305
PDB:
3CQJ
PDB:
3CQI
PDB:
3CQH
PFAM:
PF01261
PRIDE:
P39305
PRODB:
PRO_000024179
REFSEQ:
NP_418618
SMR:
P39305
UNIPROT:
P39305


Operon      
Name: ulaABCDEF         
Operon arrangement:
Transcription unit        Promoter
ulaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IHF, UlaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Yew WS., Gerlt JA., 2002, Utilization of L-ascorbate by Escherichia coli K-12: assignments of functions to products of the yjf-sga and yia-sgb operons., J Bacteriol 184(1):302-6


RegulonDB