RegulonDB RegulonDB 10.9: Gene Form
   

ulaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaE ulaF ulaD yjfY

Gene      
Name: ulaF    Texpresso search in the literature
Synonym(s): ECK4194, G7860, b4198, sgaE, yjfX
Genome position(nucleotides): 4423700 --> 4424386 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.21
External database links:  
ASAP:
ABE-0013734
ECHOBASE:
EB2391
ECOLIHUB:
ulaF
OU-MICROARRAY:
b4198
STRING:
511145.b4198
COLOMBOS: ulaF


Product      
Name: L-ribulose-5-phosphate 4-epimerase UlaF
Synonym(s): SgaE, UlaF, YjfX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.278
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
72 -> 73 SS
6 -> 193 QQVFEANMELPRYGLVTFTWGNVSAIDRERGLVVIKPSGVAYETMKAADMVVVDMSGKVVEGEYRPSSDTATHLELYRRYPSLGGIVHTHSTHATAWAQAGLAIPALGTTHADYFFGDIPCTRGLSEEEVQGEYELNTGKVIIETLGNAEPLHTPGIVVYQHGPFAWGKDAHDAVHNAVVMEEVAKMA
26 -> 27 GN
43 -> 44 SG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016832 - aldehyde-lyase activity
GO:0008270 - zinc ion binding
GO:0008742 - L-ribulose-phosphate 4-epimerase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0019323 - pentose catabolic process
GO:0019852 - L-ascorbic acid metabolic process
GO:0019854 - L-ascorbic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10868N
ECOCYC:
G7860-MONOMER
ECOLIWIKI:
b4198
INTERPRO:
IPR001303
INTERPRO:
IPR023499
INTERPRO:
IPR036409
MODBASE:
P39306
PFAM:
PF00596
PRIDE:
P39306
PRODB:
PRO_000024180
REFSEQ:
NP_418619
SMART:
SM01007
SMR:
P39306
SWISSMODEL:
P39306
UNIPROT:
P39306


Operon      
Name: ulaABCDEF         
Operon arrangement:
Transcription unit        Promoter
ulaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IHF, UlaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB