RegulonDB RegulonDB 10.10: Gene Form
   

yjfY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaF rpsF yjfY CRP TSS_5058 TSS_5058 TSS_5057 TSS_5057 rpsFp rpsFp TSS_5055 TSS_5055 yjfYp2 yjfYp2

Gene      
Name: yjfY    Texpresso search in the literature
Synonym(s): ECK4195, G7861, b4199
Genome position(nucleotides): 4424516 <-- 4424791 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.01
External database links:  
ASAP:
ABE-0013736
ECHOBASE:
EB2392
ECOLIHUB:
yjfY
OU-MICROARRAY:
b4199
STRING:
511145.b4199
COLOMBOS: yjfY


Product      
Name: DUF1471 domain-containing protein YjfY
Synonym(s): YjfY
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 10.149
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
36 -> 91 QSLGVIYINHNFATESEARQALNEETDAQGATYYHVILMREPGSNGNMHASADIYR
21 -> 91 AIEINNHQARNMDDVQSLGVIYINHNFATESEARQALNEETDAQGATYYHVILMREPGSNGNMHASADIYR
1 -> 20 MFSRVLALLAVLLLSANTWA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0042597 - periplasmic space
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7861-MONOMER
ECOLIWIKI:
b4199
INTERPRO:
IPR025543
INTERPRO:
IPR036275
INTERPRO:
IPR010854
PFAM:
PF07338
PRIDE:
P0AF86
REFSEQ:
NP_418620
SMR:
P0AF86
UNIPROT:
P0AF86


Operon      
Name: yjfY         
Operon arrangement:
Transcription unit        Promoter
yjfY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjfYp2 4424828 reverse nd [ICWHO] [1]
  promoter TSS_5055 4424843 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5057 4425027 forward nd [RS-EPT-CBR] [2]
  promoter TSS_5058 4425138 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB