RegulonDB RegulonDB 10.10: Gene Form
   

ytfB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjfZ ytfB fklB ytfA TSS_5064 TSS_5064 ytfBp ytfBp TSS_5062 TSS_5062 yjfZp7 yjfZp7 yjfZp8 yjfZp8

Gene      
Name: ytfB    Texpresso search in the literature
Synonym(s): ECK4202, G7864, b4206
Genome position(nucleotides): 4428079 <-- 4428717 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.71
External database links:  
ASAP:
ABE-0013756
ECHOBASE:
EB2395
ECOLIHUB:
ytfB
OU-MICROARRAY:
b4206
STRING:
511145.b4206
COLOMBOS: ytfB


Product      
Name: cell division protein YtfB
Synonym(s): YtfB
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,inner membrane
Molecular weight: 23.505
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
117 -> 212 PFQPDSGIDNQWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAGKPLSNLQNGQMVKIRQNASGVVTGLTIDTGNNQQVLFTRQPDGSFIRAR
127 -> 211 QWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAGKPLSNLQNGQMVKIRQNASGVVTGLTIDTGNNQQVLFTRQPDGSFIRA
34 -> 50 GIIIAAIVLVVGFLLPS
23 -> 50 FMDPLPPMHRRGIIIAAIVLVVGFLLPS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005576 - extracellular region
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0004222 - metalloendopeptidase activity
GO:0042834 - peptidoglycan binding
biological_process GO:0051301 - cell division
GO:0006508 - proteolysis
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000920 - septum digestion after cytokinesis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7864-MONOMER
ECOLIWIKI:
b4206
INTERPRO:
IPR013731
INTERPRO:
IPR007340
PFAM:
PF04225
PFAM:
PF08525
PRIDE:
P39310
REFSEQ:
NP_418627
UNIPROT:
P39310


Operon      
Name: ytfB         
Operon arrangement:
Transcription unit        Promoter
ytfB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjfZp8 4427517 reverse nd [ICWHO] [1]
  promoter yjfZp7 4427526 reverse nd [ICWHO] [1]
  promoter TSS_5062 4428742 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5064 4428908 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB