RegulonDB RegulonDB 10.10: Gene Form
   

fklB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cycA ytfB fklB ytfA GcvB TSS_5069 TSS_5069 TSS_5068 TSS_5068 TSS_5067 (cluster) TSS_5067 (cluster) cycAp cycAp TSS_5065 TSS_5065 TSS_5064 TSS_5064 ytfBp ytfBp TSS_5062 TSS_5062

Gene      
Name: fklB    Texpresso search in the literature
Synonym(s): ECK4203, G7865, b4207, ytfC
Genome position(nucleotides): 4428935 --> 4429555 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.72
External database links:  
ASAP:
ABE-0013759
ECHOBASE:
EB2396
ECOLIHUB:
fklB
OU-MICROARRAY:
b4207
STRING:
511145.b4207
COLOMBOS: fklB


Product      
Name: peptidyl-prolyl cis-trans isomerase FklB
Synonym(s): FKBP-type peptidyl-prolyl cis-trans isomerase FklB, FKBP22, FklB, YtfC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space
Molecular weight: 22.216
Isoelectric point: 4.558
Motif(s):
 
Type Positions Sequence
15 -> 15 Y
120 -> 206 TDRVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIPGWIEALTLMPVGSKWELTIPQELAYGERGAGASIPPFSTLVFEVELLEIL
55 -> 92 VDVVHRALREIHERADAVRRQRFQAMAAEGVKYLEENA
11 -> 108 AQASYGIGLQVGQQLSESGLEGLLPEALVAGIADALEGKHPAVPVDVVHRALREIHERADAVRRQRFQAMAAEGVKYLEENAKKEGVNSTESGLQFRV
117 -> 203 PARTDRVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIPGWIEALTLMPVGSKWELTIPQELAYGERGAGASIPPFSTLVFEVELL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0042597 - periplasmic space
molecular_function GO:0016853 - isomerase activity
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0005528 - FK506 binding
biological_process GO:0006457 - protein folding
GO:0061077 - chaperone-mediated protein folding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-31854N
ECOCYC:
G7865-MONOMER
ECOLIWIKI:
b4207
INTERPRO:
IPR000774
INTERPRO:
IPR001179
INTERPRO:
IPR036944
MINT:
P0A9L3
PFAM:
PF00254
PFAM:
PF01346
PRIDE:
P0A9L3
PRODB:
PRO_000022632
PROSITE:
PS50059
REFSEQ:
NP_418628
SMR:
P0A9L3
UNIPROT:
P0A9L3


Operon      
Name: fklB         
Operon arrangement:
Transcription unit        Promoter
fklB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5062 4428742 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5064 4428908 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5065 4429770 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5067 (cluster) 4429811 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5068 4430493 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5069 4431082 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB