RegulonDB RegulonDB 10.10: Gene Form
   

qorB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ytfF qorB ytfH ytfHp6 ytfHp6 TSS_5070 TSS_5070 ytfHp5 ytfHp5 ytfFp5 ytfFp5 ytfFp6 ytfFp6

Gene      
Name: qorB    Texpresso search in the literature
Synonym(s): ECK4207, G7868, b4211, ytfG
Genome position(nucleotides): 4433164 <-- 4434024 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.24
External database links:  
ASAP:
ABE-0013773
ECHOBASE:
EB2400
ECOLIHUB:
ytfG
OU-MICROARRAY:
b4211
STRING:
511145.b4211
COLOMBOS: qorB


Product      
Name: NAD(P)H:quinone oxidoreductase
Synonym(s): QOR2, QorB, YtfG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.733
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
6 -> 11 GATGQL
2 -> 220 IAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISSSEVGQRAPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQ
73 -> 75 SSS
139 -> 139 W
138 -> 143 GWYSEN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016655 - oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0003955 - NAD(P)H dehydrogenase (quinone) activity
GO:0008753 - NADPH dehydrogenase (quinone) activity
GO:0050136 - NADH dehydrogenase (quinone) activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12935N
ECOCYC:
G7868-MONOMER
ECOLIWIKI:
b4211
INTERPRO:
IPR036291
INTERPRO:
IPR008030
MODBASE:
P39315
PDB:
2ZCU
PDB:
2ZCV
PFAM:
PF05368
PRIDE:
P39315
REFSEQ:
NP_418632
SMR:
P39315
UNIPROT:
P39315


Operon      
Name: qorB         
Operon arrangement:
Transcription unit        Promoter
qorB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ytfFp6 4433131 reverse nd [ICWHO] [1]
  promoter ytfFp5 4433148 reverse nd [ICWHO] [1]
  promoter ytfHp5 4434082 forward nd [ICWHO] [1]
  promoter TSS_5070 4434083 forward nd [RS-EPT-CBR] [2]
  promoter ytfHp6 4434104 forward nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB