RegulonDB RegulonDB 10.9: Gene Form
   

bdcA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bdcA bdcR yjgH unknown unknown NsrR terminator TSS_5096 TSS_5096 bdcRp4 bdcRp4 bdcAp bdcAp

Gene      
Name: bdcA    Texpresso search in the literature
Synonym(s): ECK4243, G7880, b4249, yjgI
Genome position(nucleotides): 4473340 <-- 4474053 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.34
External database links:  
ASAP:
ABE-0013909
ECHOBASE:
EB2418
ECOLIHUB:
yjgI
OU-MICROARRAY:
b4249
STRING:
511145.b4249
COLOMBOS: bdcA


Product      
Name: c-di-GMP-binding biofilm dispersal mediator protein
Synonym(s): BdcA, YjgI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.598
Isoelectric point: 7.088
Motif(s):
 
Type Positions Sequence
15 -> 233 SRGIGAAIVRRFVTDGANVRFTYAGSKDAAKRLAQETGATAVFTDSADRDAVIDVVRKSGALDILVVNAGIGVFGEALELNADDIDRLFKINIHAPYHASVEAARQMPEGGRILIIGSVNGDRMPVAGMAAYAASKSALQGMARGLARDFGPRGITINVVQPGPIDTDANPANGPMRDMLHSLMAIKRHGQPEEVAGMVAWLAGPEASFVTGAMHTIDG
10 -> 34 LILGGSRGIGAAIVRRFVTDGANVR
50 -> 50 E

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0042803 - protein homodimerization activity
GO:0035438 - cyclic-di-GMP binding
GO:0070402 - NADPH binding
biological_process GO:0055114 - oxidation-reduction process
GO:0044010 - single-species biofilm formation
External database links:  
DIP:
DIP-12604N
ECOCYC:
G7880-MONOMER
ECOLIWIKI:
b4249
INTERPRO:
IPR036291
INTERPRO:
IPR002347
INTERPRO:
IPR020904
MODBASE:
P39333
PDB:
5Z2L
PFAM:
PF13561
PRIDE:
P39333
PRINTS:
PR00080
PRINTS:
PR00081
PROSITE:
PS00061
REFSEQ:
NP_418670
SMR:
P39333
UNIPROT:
P39333


Operon      
Name: bdcA         
Operon arrangement:
Transcription unit        Promoter
bdcA


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter bdcRp4 4474096 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_5096 4474512 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB