RegulonDB RegulonDB 10.9: Gene Form
   

rraB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argI yjgM rraB ArgR ArgR DksA-ppGpp DksA-ppGpp ppGpp rraBp2 rraBp2 rraBp1 rraBp1 argIp argIp

Gene      
Name: rraB    Texpresso search in the literature
Synonym(s): ECK4248, G7885, b4255, yjgD
Genome position(nucleotides): 4478473 --> 4478889 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.92
External database links:  
ASAP:
ABE-0013936
ECHOBASE:
EB2347
ECOLIHUB:
rraB
OU-MICROARRAY:
b4255
STRING:
511145.b4255
COLOMBOS: rraB


Product      
Name: ribonuclease E inhibitor protein B
Synonym(s): RraB, YjgD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.603
Isoelectric point: 3.414
Motif(s):
 
Type Positions Sequence
116 -> 134 EDPNGEDGDDEDFVDEDDD
12 -> 113 EETRLIIEELLEDGSDPDALYTIEHHLSADDLETLEKAAVEAFKLGYEVTDPEELEVEDGDIVICCDILSECALNADLIDAQVEQLMTLAEKFDVEYDGWGT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008428 - ribonuclease inhibitor activity
GO:0019899 - enzyme binding
GO:0042803 - protein homodimerization activity
GO:0060698 - endoribonuclease inhibitor activity
biological_process GO:0006402 - mRNA catabolic process
GO:0050790 - regulation of catalytic activity
GO:0043086 - negative regulation of catalytic activity
GO:0060699 - regulation of endoribonuclease activity
GO:0060702 - negative regulation of endoribonuclease activity
External database links:  
DIP:
DIP-47905N
ECOCYC:
G7885-MONOMER
ECOLIWIKI:
b4255
INTERPRO:
IPR009671
INTERPRO:
IPR016716
INTERPRO:
IPR036701
MODBASE:
P0AF90
PFAM:
PF06877
PRIDE:
P0AF90
REFSEQ:
NP_418676
SMR:
P0AF90
SWISSMODEL:
P0AF90
UNIPROT:
P0AF90


Operon      
Name: rraB         
Operon arrangement:
Transcription unit        Promoter
rraB
yjgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB