RegulonDB RegulonDB 10.9: Gene Form
   

idnR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: idnR    Texpresso search in the literature
Synonym(s): ECK4257, G7891, b4264, gntH, gntS?, yjgS
Genome position(nucleotides): 4490141 <-- 4491139 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.05
External database links:  
ASAP:
ABE-0013966
ECHOBASE:
EB2427
ECOLIHUB:
idnR
OU-MICROARRAY:
b4264
STRING:
511145.b4264
COLOMBOS: idnR


Product      
Name: DNA-binding transcriptional dual regulator IdnR
Synonym(s): GntH, IdnR, YjgS
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 37.567
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
8 -> 52 LQDIATLAGVTKMTVSRYIRSPKKVAKETGERIAKIMEEINYIPN
175 -> 327 MLEKRVRHKILYLGSKDDTRDEQRYQGYCDAMMLHNLSPLRMNPRAISSIHLGMQLMRDALSANPDLDGVFCTNDDIAMGALLLCRERNLAVPEQISIAGFHGLEIGRQMIPSLASVITPRFDIGRMAAQMLLSKIKNNDHNHNTVDLGYQIY
6 -> 60 ISLQDIATLAGVTKMTVSRYIRSPKKVAKETGERIAKIMEEINYIPNRAPGMLLN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0019521 - D-gluconate metabolic process
Reference(s): [1] Isturiz T., et al., 2001
External database links:  
ECOCYC:
G7891-MONOMER
ECOLIWIKI:
b4264
INTERPRO:
IPR010982
INTERPRO:
IPR028082
INTERPRO:
IPR000843
MODBASE:
P39343
PFAM:
PF13377
PFAM:
PF00356
PRIDE:
P39343
PRODB:
PRO_000022996
PROSITE:
PS00356
PROSITE:
PS50932
REFSEQ:
NP_418685
SMART:
SM00354
SMR:
P39343
UNIPROT:
P39343


Operon      
Name: idnDOTR         
Operon arrangement:
Transcription unit        Promoter
idnR
idnDOTR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IdnR
Repressed by: GntR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5117 4490083 reverse nd [RS-EPT-CBR] [2]
  promoter yjgRp3 4490085 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_5118 4491570 reverse nd [RS-EPT-CBR] [2]



RegulonDB