RegulonDB RegulonDB 10.9: Gene Form
   

yjhG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjhG yjhF yjhH yjhGp4 yjhGp4 yjhGp3 yjhGp3 TSS_5127 TSS_5127

Gene      
Name: yjhG    Texpresso search in the literature
Synonym(s): ECK4286, G7910, b4297
Genome position(nucleotides): 4522127 <-- 4524094 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.52
External database links:  
ASAP:
ABE-0014087
ECHOBASE:
EB2437
ECOLIHUB:
yjhG
OU-MICROARRAY:
b4297
STRING:
511145.b4297
COLOMBOS: yjhG


Product      
Name: KpLE2 phage-like element; D-xylonate dehydratase
Synonym(s): YjhG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 70.017
Isoelectric point: 6.211
Motif(s):
 
Type Positions Sequence
555 -> 556 GG
85 -> 588 LHQGHYELDIQMKAAAEVIKANHALPYAVYVSDPCDGRTQGTTGMFDSLPYRNDASMVMRRLIRSLPDAKAVIGVASCDKGLPATMMALAAQHNIATVLVPGGATLPAKDGEDNGKVQTIGARFANGELSLQDARRAGCKACASSGGGCQFLGTAGTSQVVAEGLGLAIPHSALAPSGEPVWREIARASARAALNLSQKGITTREILTDKAIENAMTVHAAFGGSTNLLLHIPAIAHQAGCHIPTVDDWIRINKRVPRLVSVLPNGPVYHPTVNAFMAGGVPEVMLHLRSLGLLHEDVMTVTGSTLKENLDWWEHSERRQRFKQLLLDQEQINADEVIMSPQQAKARGLTSTITFPVGNIAPEGSVIKSTAIDPSMIDEQGIYYHKGVAKVYLSEKSAIYDIKHDKIKAGDILVIIGVGPSGTGMEETYQVTSALKHLSYGKHVSLITDARFSGVSTGACIGHVGPEALAGGPIGKLRTGDLIEIKIDCRELHGEVNFLGTRSD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016836 - hydro-lyase activity
GO:0050401 - xylonate dehydratase activity
biological_process GO:0046176 - aldonic acid catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Zhang N., et al., 2016
External database links:  
ECOCYC:
G7910-MONOMER
ECOLIWIKI:
b4297
INTERPRO:
IPR000581
INTERPRO:
IPR017798
INTERPRO:
IPR020558
INTERPRO:
IPR037237
INTERPRO:
IPR042096
PFAM:
PF00920
PRIDE:
P39358
PROSITE:
PS00886
PROSITE:
PS00887
REFSEQ:
NP_418717
SMR:
P39358
UNIPROT:
P39358


Operon      
Name: yjhIHG         
Operon arrangement:
Transcription unit        Promoter
yjhIHG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5127 4521212 reverse nd [RS-EPT-CBR] [3]
  promoter yjhGp3 4524140 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yjhGp4 4524226 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Zhang N., Wang J., Zhang Y., Gao H., 2016, Metabolic pathway optimization for biosynthesis of 1,2,4-butanetriol from xylose by engineered Escherichia coli., Enzyme Microb Technol 93-94:51-58

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB