RegulonDB RegulonDB 10.8: Gene Form
   

nanM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nanM nanS nanC ythB nanSp1 nanSp1

Gene      
Name: nanM    Texpresso search in the literature
Synonym(s): ECK4301, G7920, b4310, yjhT
Genome position(nucleotides): 4537659 <-- 4538765 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.17
External database links:  
ASAP:
ABE-0014132
ECHOBASE:
EB2450
OU-MICROARRAY:
b4310
PortEco:
nanM
STRING:
511145.b4310
COLOMBOS: nanM


Product      
Name: N-acetylneuraminate mutarotase
Synonym(s): NanM, YjhT
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 39.572
Isoelectric point: 7.907
Motif(s):
 
Type Positions Sequence
86 -> 137 NLYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKLMSHAPMGMAGHVTFVHN
174 -> 219 HYFDKKAEDYFFNKFLLSFDPSTQQWSYAGESPWYGTAGAAVVNKG
287 -> 336 ENYQNGKNYAHEGLKKSYSTDIHLWHNGKWDKSGELSQGRAYGVSLPWNN
302 -> 302 K
40 -> 84 TVYIGLGSAGTAWYKLDTQAKDKKWTALAAFPGGPRDQATSAFID

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016853 - isomerase activity
GO:0016857 - racemase and epimerase activity, acting on carbohydrates and derivatives
biological_process GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12628N
ECOCYC:
G7920-MONOMER
ECOLIWIKI:
b4310
INTERPRO:
IPR019936
INTERPRO:
IPR015915
MODBASE:
P39371
PDB:
2UVK
PFAM:
PF13418
PRIDE:
P39371
PRODB:
PRO_000023343
REFSEQ:
NP_418730
SMR:
P39371
UNIPROT:
P39371


Operon      
Name: nanCMS         
Operon arrangement:
Transcription unit        Promoter
nanCM
nanCMS
yjhA
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: NagC, NanR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nanSp1 4537703 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB