RegulonDB RegulonDB 10.9: Gene Form
   

iraD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

iadA hypT iraD ytiD idlP ytiC DksA ppGpp hypTp4 hypTp4 iraDp2 iraDp2

Gene      
Name: iraD    Texpresso search in the literature
Synonym(s): ECK4317, G7923, b4326, yjiD
Genome position(nucleotides): 4556993 --> 4557385 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.85
External database links:  
ASAP:
ABE-0014190
ECHOBASE:
EB2453
ECOLIHUB:
iraD
OU-MICROARRAY:
b4326
STRING:
511145.b4326
COLOMBOS: iraD


Product      
Name: anti-adaptor protein IraD, inhibitor of σS proteolysis
Synonym(s): IraD, YjiD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.747
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
20 -> 106 SLRKSVCSDLLTLFNSPHSALPSLLVSGMPEWQVHNPSDKHLQSWYCRQLRSALLFHEPRIAALQVNLKEAYCHTLAISLEIMLYHD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0043856 - anti-sigma factor antagonist activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0042177 - negative regulation of protein catabolic process
GO:0034599 - cellular response to oxidative stress
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Bougdour A., et al., 2008
[2] Hamdallah I., et al., 2018
External database links:  
ECOCYC:
G7923-MONOMER
ECOLIWIKI:
b4326
INTERPRO:
IPR007048
INTERPRO:
IPR023776
PDB:
6OD1
PFAM:
PF04965
PRIDE:
P39375
PRODB:
PRO_000023028
REFSEQ:
NP_418746
SMR:
P39375
UNIPROT:
P39375


Operon      
Name: ytiCD-idlP-iraD         
Operon arrangement:
Transcription unit        Promoter
iraD
iraD
iraD


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hypTp4 4558317 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bougdour A., Cunning C., Baptiste PJ., Elliott T., Gottesman S., 2008, Multiple pathways for regulation of sigmaS (RpoS) stability in Escherichia coli via the action of multiple anti-adaptors., Mol Microbiol 68(2):298-313

 [2] Hamdallah I., Torok N., Bischof KM., Majdalani N., Chadalavada S., Mdluli N., Creamer KE., Clark M., Holdener C., Basting PJ., Gottesman S., Slonczewski JL., 2018, Experimental Evolution of Escherichia coli K-12 at High pH and with RpoS Induction., Appl Environ Microbiol 84(15)

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB