RegulonDB RegulonDB 10.9: Gene Form
   

btsT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btsT tsr yjiX CRP BtsR CpxR terminator terminator tsrp tsrp tsrp1 tsrp1 yjiYp yjiYp yjiYp3 yjiYp3 yjiAp7 yjiAp7 yjiAp6 yjiAp6

Gene      
Name: btsT    Texpresso search in the literature
Synonym(s): ECK4344, G7942, b4354, yjiY
Genome position(nucleotides): 4589129 <-- 4591279 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.07
External database links:  
ASAP:
ABE-0014278
ECHOBASE:
EB2472
ECOLIHUB:
yjiY
OU-MICROARRAY:
b4354
STRING:
511145.b4354
COLOMBOS: btsT


Product      
Name: pyruvate:H+ symporter
Synonym(s): BtsT, YjiY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 77.324
Isoelectric point: 8.931
Motif(s):
 
Type Positions Sequence
283 -> 303 YLATFLKIGVIVGLALGIVVL
34 -> 405 ISALWIVVASVSVYLVAYRYYSLYIAQKVMKLDPTRATPAVINNDGLNYVPTNRYVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWLLAGVVLAGAVQDFMVLFISSRRNGASLGEMIKEEMGPVPGTIALFGCFLIMIIILAVLALIVVKALAESPWGVFTVCSTVPIALFMGIYMRFIRPGRVGEVSVIGIVLLVASIYFGGVIAHDPYWGPALTFKDTTITFALIGYAFVSALLPVWLILAPRDYLATFLKIGVIVGLALGIVVLNPELKMPAMTQYIDGTGPLWKGALFPFLFITIACGAVSGFHALISSGTTPKLLANETDARFIGYGAMLMESFVAIMALVAASIIEPGLYFAMNTPPAGLGIT
487 -> 614 GFWYHFGILFEALFILTALDAGTRSGRFMLQDLLGNFIPFLKKTDSLVAGIIGTAGCVGLWGYLLYQGVVDPLGGVKSLWPLFGISNQMLAAVALVLGTVVLIKMKRTQYIWVTVVPAVWLLICTTWA
375 -> 395 FVAIMALVAASIIEPGLYFAM
464 -> 484 GGAPTLAVGIAHVFHKVLPMA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005477 - pyruvate secondary active transmembrane transporter activity
GO:0005515 - protein binding
GO:0015293 - symporter activity
GO:0042802 - identical protein binding
biological_process GO:0006849 - plasma membrane pyruvate transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0009267 - cellular response to starvation
GO:0031669 - cellular response to nutrient levels
Note(s): Note(s): ...[more].
Reference(s): [1] Hwang S., et al., 2018
[2] Kornberg HL., et al., 1967
[3] Kreth J., et al., 2013
[4] Lang VJ., et al., 1987
[5] Matin A., et al., 1973
[6] Vilhena C., et al., 2019
External database links:  
DIP:
DIP-12649N
ECOCYC:
G7942-MONOMER
ECOLIWIKI:
b4354
INTERPRO:
IPR003706
INTERPRO:
IPR025299
PFAM:
PF13722
PFAM:
PF02554
PRIDE:
P39396
REFSEQ:
NP_418774
UNIPROT:
P39396


Operon      
Name: btsT         
Operon arrangement:
Transcription unit        Promoter
btsT


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, BtsR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiAp6 4588995 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yjiAp7 4589048 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yjiYp3 4591347 reverse Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hwang S., Choe D., Yoo M., Kim SC., Cho S., Cho BK., 2018, Peptide Transporter CstA Imports Pyruvate in Escherichia coli K-12., J Bacteriol 200(7)

 [2] Kornberg HL., Smith J., 1967, Genetic control of the uptake of pyruvate by Escherichia coli., Biochim Biophys Acta 148(2):591-2

 [3] Kreth J., Lengeler JW., Jahreis K., 2013, Characterization of pyruvate uptake in Escherichia coli K-12., PLoS One 8(6):e67125

 [4] Lang VJ., Leystra-Lantz C., Cook RA., 1987, Characterization of the specific pyruvate transport system in Escherichia coli K-12., J Bacteriol 169(1):380-5

 [5] Matin A., Konings WN., 1973, Transport of lactate and succinate by membrane vesicles of Escherichia coli, Bacillus subtilis and a pseudomonas species., Eur J Biochem 34(1):58-67

 [6] Vilhena C., Kaganovitch E., Grunberger A., Motz M., Forne I., Kohlheyer D., Jung K., 2019, Importance of Pyruvate Sensing and Transport for the Resuscitation of Viable but Nonculturable Escherichia coli K-12., J Bacteriol 201(3)

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB