RegulonDB RegulonDB 10.10: Gene Form
   

fhuF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuF bglJ yjjZ yjjQ OxyR Fur OxyR Fur Fur Fur OxyR OxyR yjjZp yjjZp fhuFp2 fhuFp2 fhuFp fhuFp

Gene      
Name: fhuF    Texpresso search in the literature
Synonym(s): ECK4357, G7949, b4367, yjjS
Genome position(nucleotides): 4604875 <-- 4605663 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.11
External database links:  
ASAP:
ABE-0014326
ECHOBASE:
EB2480
ECOLIHUB:
fhuF
OU-MICROARRAY:
b4367
STRING:
511145.b4367
COLOMBOS: fhuF


Product      
Name: ferric-siderophore reductase FhuF
Synonym(s): FhuF, YjjS, hydroxamate siderophore iron reductase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 30.113
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
241 -> 261 RRTCCQRYRLPDVQQCGDCTL
93 -> 236 SLWAQWYIGLMVPPLMLALLTQEKALDVSPEHFHAEFHETGRVACFWVDVCEDKNATPHSPQHRMETLISQALVPVVQALEATGEINGKLIWSNTGYLINWYLTEMKQLLGEATVESLRHALFFEKTLTNGEDNPLWRTVVLRD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0000293 - ferric-chelate reductase activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0016722 - oxidoreductase activity, acting on metal ions
biological_process GO:0033215 - reductive iron assimilation
GO:0033214 - siderophore-dependent iron import into cell
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Matzanke BF., et al., 2004
[2] Muller K., et al., 1998
External database links:  
DIP:
DIP-9607N
ECOCYC:
G7949-MONOMER
ECOLIWIKI:
b4367
INTERPRO:
IPR024726
INTERPRO:
IPR022770
INTERPRO:
IPR008090
PFAM:
PF06276
PFAM:
PF11575
PRIDE:
P39405
PRINTS:
PR01714
PRODB:
PRO_000022614
REFSEQ:
NP_418787
SMR:
P39405
UNIPROT:
P39405


Operon      
Name: fhuF         
Operon arrangement:
Transcription unit        Promoter
fhuF
fhuF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Matzanke BF., Anemuller S., Schunemann V., Trautwein AX., Hantke K., 2004, FhuF, part of a siderophore-reductase system., Biochemistry 43(5):1386-92

 [2] Muller K., Matzanke BF., Schunemann V., Trautwein AX., Hantke K., 1998, FhuF, an iron-regulated protein of Escherichia coli with a new type of [2Fe-2S] center., Eur J Biochem 258(3):1001-8


RegulonDB