RegulonDB RegulonDB 10.9: Gene Form
   

fhuF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuF bglJ yjjZ yjjQ OxyR Fur OxyR Fur Fur Fur OxyR OxyR yjjZp yjjZp fhuFp2 fhuFp2 fhuFp fhuFp

Gene      
Name: fhuF    Texpresso search in the literature
Synonym(s): ECK4357, G7949, b4367, yjjS
Genome position(nucleotides): 4604875 <-- 4605663 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.11
External database links:  
ASAP:
ABE-0014326
ECHOBASE:
EB2480
ECOLIHUB:
fhuF
OU-MICROARRAY:
b4367
STRING:
511145.b4367
COLOMBOS: fhuF


Product      
Name: hydroxamate siderophore iron reductase
Synonym(s): FhuF, YjjS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 30.113
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
241 -> 261 RRTCCQRYRLPDVQQCGDCTL
93 -> 236 SLWAQWYIGLMVPPLMLALLTQEKALDVSPEHFHAEFHETGRVACFWVDVCEDKNATPHSPQHRMETLISQALVPVVQALEATGEINGKLIWSNTGYLINWYLTEMKQLLGEATVESLRHALFFEKTLTNGEDNPLWRTVVLRD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0033215 - reductive iron assimilation
GO:0033214 - siderophore-dependent iron import into cell
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Matzanke BF., et al., 2004
[2] Nelson M., et al., 1992
External database links:  
DIP:
DIP-9607N
ECOCYC:
G7949-MONOMER
ECOLIWIKI:
b4367
INTERPRO:
IPR008090
INTERPRO:
IPR022770
INTERPRO:
IPR024726
PFAM:
PF11575
PFAM:
PF06276
PRIDE:
P39405
PRINTS:
PR01714
PRODB:
PRO_000022614
REFSEQ:
NP_418787
SMR:
P39405
UNIPROT:
P39405


Operon      
Name: fhuF         
Operon arrangement:
Transcription unit        Promoter
fhuF
fhuF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, OxyR
Growth Conditions:

[1] 

C: Escherichia coli| MacConkey agar| (NH4)2Fe(SO4)2 30 µM| 30.0 C
E: Escherichia coli| MacConkey agar| (NH4)2Fe(SO4)2 30 µM; desferrioxamine B mesylate 20 mM| 30.0 C

[2] 

C: Escherichia coli| MacConkey agar| (NH4)2Fe(SO4)2 30 µM| 30.0 C
E: Escherichia coli| MacConkey agar| (NH4)2Fe(SO4)2 30 µM; 2,2?-bipyridine 20 mM| 30.0 C



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Matzanke BF., Anemuller S., Schunemann V., Trautwein AX., Hantke K., 2004, FhuF, part of a siderophore-reductase system., Biochemistry 43(5):1386-92

 [2] Nelson M., Carrano CJ., Szaniszlo PJ., 1992, Identification of the ferrioxamine B receptor, FoxB, in Escherichia coli K12., Biometals 5(1):37-46


RegulonDB