RegulonDB RegulonDB 10.8: Gene Form
   

mhpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: mhpA    Texpresso search in the literature
Synonym(s): ECK0344, M010, b0347
Genome position(nucleotides): 368611 --> 370275 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.0
External database links:  
ASAP:
ABE-0001196
ECHOBASE:
EB4166
OU-MICROARRAY:
b0347
PortEco:
mhpA
STRING:
511145.b0347
COLOMBOS: mhpA


Product      
Name: 3-(3-hydroxyphenyl)propanoate hydroxylase
Synonym(s): MhpA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 62.186
Isoelectric point: 7.922
Motif(s):
 
Type Positions Sequence
502 -> 502 W
285 -> 295 FRIDRVLLAGD
16 -> 352 VQVAIAGAGPVGLMMANYLGQMGIDVLVVEKLDKLIDYPRAIGIDDEALRTMQSVGLVDDVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWPRRNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAEGQREIVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRPYVSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQERRDHAKAMIDL
17 -> 46 QVAIAGAGPVGLMMANYLGQMGIDVLVVEK
272 -> 272 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0042802 - identical protein binding
GO:0008688 - 3-(3-hydroxyphenyl)propionate hydroxylase activity
GO:0071949 - FAD binding
biological_process GO:0019439 - aromatic compound catabolic process
GO:0055114 - oxidation-reduction process
GO:0019380 - 3-phenylpropionate catabolic process
GO:0019622 - 3-(3-hydroxy)phenylpropionate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Xu Y., et al., 2020
External database links:  
ECOCYC:
MHPHYDROXY-MONOMER
ECOLIWIKI:
b0347
INTERPRO:
IPR002938
INTERPRO:
IPR036188
INTERPRO:
IPR023786
MODBASE:
P77397
PFAM:
PF01494
PRIDE:
P77397
PRINTS:
PR00420
PRODB:
PRO_000023228
REFSEQ:
NP_414881
SMR:
P77397
UNIPROT:
P77397


Operon      
Name: mhpABCDFE         
Operon arrangement:
Transcription unit        Promoter
mhpABCDFE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, MhpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB