RegulonDB RegulonDB 10.9: Gene Form
   

mhpD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mhpE mhpF mhpC mhpD

Gene      
Name: mhpD    Texpresso search in the literature
Synonym(s): ECK0347, M013, b0350, mhpS
Genome position(nucleotides): 372115 --> 372924 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.19
External database links:  
ASAP:
ABE-0001205
ECHOBASE:
EB4022
ECOLIHUB:
mhpD
OU-MICROARRAY:
b0350
STRING:
511145.b0350
COLOMBOS: mhpD


Product      
Name: 2-hydroxypentadienoate hydratase
Synonym(s): MhpD, MhpS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.89
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
202 -> 202 G
74 -> 259 VDQPDFGTLFADMCYGDNEIIPFSRVLQPRIEAEIALVLNRDLPATDITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVADNASCGVYVIGGPAQRPAGLDLKNCAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPLRTGDIILTGALGPMVAVNAGDRFEAHIEGIGSVAATF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0008684 - 2-oxopent-4-enoate hydratase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
biological_process GO:0019439 - aromatic compound catabolic process
GO:0019380 - 3-phenylpropionate catabolic process
External database links:  
ECOCYC:
MHPDHYDROL-MONOMER
ECOLIWIKI:
b0350
INTERPRO:
IPR023793
INTERPRO:
IPR036663
INTERPRO:
IPR011234
MODBASE:
P77608
PDB:
1SV6
PDB:
2WQT
PFAM:
PF01557
PRIDE:
P77608
PRODB:
PRO_000023231
REFSEQ:
NP_414884
SMR:
P77608
UNIPROT:
P77608


Operon      
Name: mhpABCDFE         
Operon arrangement:
Transcription unit        Promoter
mhpABCDFE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, MhpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB