RegulonDB RegulonDB 10.9: Gene Form
   

insA4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB4 insB4 gfcA insA4 cspH YjjQ YjjQ gfcAp gfcAp TSS_1309 (cluster) TSS_1309 (cluster) TSS_1308 TSS_1308 gfcAp1 gfcAp1

Gene      
Name: insA4    Texpresso search in the literature
Synonym(s): ECK0023, G0-10430, b4516
Genome position(nucleotides): 1049833 --> 1050108 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.9
External database links:  
ASAP:
ABE-0285037
ECHOBASE:
EB4390
ECOLIHUB:
insA-4
STRING:
511145.b4516
COLOMBOS: insA4


Product      
Name: IS1 protein InsA
Synonym(s): InsA4
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.902
Isoelectric point: 10.862
Motif(s):
 
Type Positions Sequence
43 -> 88 FTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKNSG
1 -> 36 MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCR

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
DIP:
DIP-16998N
ECOCYC:
MONOMER0-4228
ECOLIWIKI:
b4516
INTERPRO:
IPR003220
INTERPRO:
IPR024431
PFAM:
PF12759
PFAM:
PF03811
PRIDE:
P0CF10
REFSEQ:
YP_588445
UNIPROT:
P0CF10


Operon      
Name: insA4AB4B4         
Operon arrangement:
Transcription unit        Promoter
insA4AB4B4


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gfcAp1 1049834 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1308 1049998 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1309 (cluster) 1050701 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB