RegulonDB RegulonDB 10.9: Gene Form
   

ykfH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykfG yafW ykfH ykfIp7 ykfIp7

Gene      
Name: ykfH    Texpresso search in the literature
Synonym(s): ECK0248, G0-10432, b4504
Genome position(nucleotides): 264026 <-- 264247 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.86
External database links:  
ASAP:
ABE-0285025
ECHOBASE:
EB4078
ECOLIHUB:
ykfH
STRING:
511145.b4504
COLOMBOS: ykfH


Product      
Name: DUF987 domain-containing protein YkfH
Synonym(s): YkfH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.581
Isoelectric point: 10.014
Motif(s):
 
Type Positions Sequence
1 -> 64 MKIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPDIAGVLAVYAERRQDRNGPY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2654
ECOLIWIKI:
b4504
INTERPRO:
IPR009329
PFAM:
PF06174
PRIDE:
Q9XB42
REFSEQ:
YP_588435
SMR:
Q9XB42
UNIPROT:
Q9XB42


Operon      
Name: yafY-ykfBF-yafX-ykfGH-yafW-ykfI         
Operon arrangement:
Transcription unit        Promoter
ykfBF-yafX-ykfGH-yafW-ykfI
ykfBF-yafX-ykfGH-yafW-ykfI
ykfGH-yafW-ykfI
yafY-ykfBF-yafX-ykfGH-yafW-ykfI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ykfIp7 263818 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB