RegulonDB RegulonDB 11.1: Gene Form
   

rzoD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrrD rzpD borD rzoD

Gene      
Name: rzoD    Texpresso search in the literature
Synonym(s): ECK0548, G0-10436, b4510
Genome position(nucleotides): 578327 --> 578509
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.83
External database links:  
ASAP:
ABE-0285031
ECHOBASE:
EB4123
ECOLIHUB:
rzoD
STRING:
511145.b4510
COLOMBOS: rzoD


Product      
Name: DLP12 prophage; putative prophage lysis lipoprotein RzoD
Synonym(s): RzoD
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 6.69
Isoelectric point: 10.35
Motif(s):
 
Type Positions Sequence Comment
1 -> 19 MRKLKMMLCVMMLPLVVVG
20 -> 60 CTSKQSVSQCVKPPRPPAWIMQPPPDWQTPLNGIISPSERG UniProt: Prophage outer membrane lipoprotein RzoD.

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
biological_process GO:0019076 - viral release from host cell
GO:0019835 - cytolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Rao S., et al., 2020
External database links:  
ALPHAFOLD:
P58041
ECOCYC:
MONOMER0-2658
ECOLIWIKI:
b4510
INTERPRO:
IPR010346
PFAM:
PF06085
PRIDE:
P58041
PROSITE:
PS51257
REFSEQ:
YP_588440
UNIPROT:
P58041


Operon      
Name: rzoD         
Operon arrangement:
Transcription unit        Promoter
rzoD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3


RegulonDB