RegulonDB RegulonDB 11.1: Gene Form

ymdF gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

rutG wrbA ycdF ymdF CsgD CsgD CsgD wrbAp wrbAp

Name: ymdF    Texpresso search in the literature
Synonym(s): ECK0996, G0-10443, b4518
Genome position(nucleotides): 1068081 --> 1068254
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: stress-induced bacterial acidophilic repeat motifs-containing protein YmdF
Synonym(s): YmdF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 5.883
Isoelectric point: 10.657
Type Positions Sequence Comment
1 -> 57 MANHRGGSGNFAEDRERASEAGKKGGQHSGGNFKNDPQRASEAGKKGGKSSHGKSDN UniProt: Disordered; Sequence Annotation Type: region of interest.
9 -> 23 GNFAEDRERASEAGK UniProt: Basic and acidic residues; Sequence Annotation Type: compositionally biased region.
39 -> 57 RASEAGKKGGKSSHGKSDN UniProt: Basic and acidic residues; Sequence Annotation Type: compositionally biased region.


Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Oguri T., et al., 2018
External database links:  

Name: ymdF         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


 [1] Oguri T., Kwon Y., Woo JKK., Prehna G., Ning M., Won KJ., Lee J., Mei S., Shi Y., Jeong H., Lee H., 2018, A family of small intrinsically disordered proteins involved in flagella-dependent motility in Salmonella., J Bacteriol
