RegulonDB RegulonDB 10.9: Gene Form
   

rzoR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trkG ydaW rzpR rzoR b1364 ynaKp10 ynaKp10 trkGp8 trkGp8 trkGp1 trkGp1 trkGp7 trkGp7

Gene      
Name: rzoR    Texpresso search in the literature
Synonym(s): ECK1361, G0-10449, b4528
Genome position(nucleotides): 1423400 --> 1423585 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.99
External database links:  
ASAP:
ABE-0285049
ECHOBASE:
EB4124
ECOLIHUB:
rzoR
STRING:
511145.b4528
COLOMBOS: rzoR


Product      
Name: Rac prophage; putative prophage outer membrane lipoprotein RzoR
Synonym(s): RzoR
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 6.761
Isoelectric point: 8.975
Motif(s):
 
Type Positions Sequence
32 -> 36 PPPPP
1 -> 19 MRKLKMMLCVMMLPLVVVG
20 -> 61 CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
biological_process GO:0019076 - viral release from host cell
GO:0019835 - cytolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2671
ECOLIWIKI:
b4528
INTERPRO:
IPR010346
PFAM:
PF06085
PRIDE:
P58042
PROSITE:
PS51257
REFSEQ:
YP_588452
UNIPROT:
P58042


Operon      
Name: rzoR         
Operon arrangement:
Transcription unit        Promoter
rzoR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter trkGp7 1423671 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter trkGp1 1423741 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter trkGp8 1423749 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynaKp10 1425219 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB