RegulonDB RegulonDB 10.9: Gene Form
   

yoeF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yoeF yeeX yeeW yoeD cbtA terminator anti-terminator anti-anti-terminator TSS_2312 TSS_2312

Gene      
Name: yoeF    Texpresso search in the literature
Synonym(s): ECK2000, G0-10456, b4538
Genome position(nucleotides): 2078575 --> 2078931 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.46
External database links:  
ASAP:
ABE-0285059
ECHOBASE:
EB4401
ECOLIHUB:
yoeF
UNIPROT:
Q2EES3
COLOMBOS: yoeF


Product      
Name: CP4-44 prophage; putative uncharacterized protein YoeF
Synonym(s): YoeF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.969
Isoelectric point: 6.912
Motif(s):
 
Type Positions Sequence
57 -> 112 RAMNHPVIGVVTKADLASMEQISLVKSWLREAGAHNVLVTSAVNNNGVTELFALLH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005524 - ATP binding
biological_process GO:0006576 - cellular biogenic amine metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2678
ECOLIWIKI:
b4538
INTERPRO:
IPR012381
INTERPRO:
IPR027417
PANTHER:
PTHR40453
PFAM:
PF10662
PRIDE:
Q2EES3
UNIPROT:
Q2EES3


Operon      
Name: yoeF         
Operon arrangement:
Transcription unit        Promoter
yoeF


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2312 2079341 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB