RegulonDB RegulonDB 10.9: Gene Form
   

insEF2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF2 insF2 insE2 ytiB insFp4 insFp4 insFp5 insFp5

Gene      
Name: insEF2    Texpresso search in the literature
Synonym(s): G0-10529
Genome position(nucleotides): 391739 <-- 392901 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
ECOLIHUB:
insEF-2
COLOMBOS: insEF2


Product      
Name: IS3 element transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 44.967
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
151 -> 200 VVLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
226 -> 323 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCC
330 -> 386 ESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNL
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
MONOMER0-4246
PFAM:
PF13333
PFAM:
PF13276
PFAM:
PF00665
PFAM:
PF01527


Operon      
Name: insEF2E2F2         
Operon arrangement:
Transcription unit        Promoter
insE2F2EF2


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insFp5 392619 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter insFp4 392660 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_488 392979 reverse nd [RS-EPT-CBR] [2]
  promoter yaiVp4 394461 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB