RegulonDB RegulonDB 10.8: Gene Form
   

insEF4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcT insEF4 insF4 ymdE insE4 ycdU ycdUp11 ycdUp11 ycdUp1 ycdUp1 ycdUp9 ycdUp9 insFp4 insFp4 insFp5 insFp5

Gene      
Name: insEF4    Texpresso search in the literature
Synonym(s): G0-10531
Genome position(nucleotides): 1094275 <-- 1095437 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
PortEco:
insEF-4
COLOMBOS: insEF4


Product      
Name: IS3 element transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 44.967
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
152 -> 200 VLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA
226 -> 339 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
MONOMER0-4248
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insEF4E4F4         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insFp5 1095155 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter insFp4 1095196 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp9 1095633 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp1 1095693 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp11 1095759 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB