RegulonDB RegulonDB 10.9: Gene Form
   

insAB4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB4 insB4 gfcA insA4 TSS_1308 TSS_1308 gfcAp1 gfcAp1

Gene      
Name: insAB4    Texpresso search in the literature
Synonym(s): G0-10536
Genome position(nucleotides): 1049833 --> 1050530 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.15
External database links:  
ECOLIHUB:
insAB-4
COLOMBOS: insAB4


Product      
Name: InsAB' transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.517
Isoelectric point: 10.657
Motif(s):
 
Type Positions Sequence
2 -> 36 ASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCR
43 -> 86 FTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKK
102 -> 232 VIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERYNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Escoubas JM., et al., 1994
External database links:  
ECOCYC:
MONOMER0-2756
PFAM:
PF03811
PFAM:
PF12759
PFAM:
PF03400


Operon      
Name: insA4AB4B4         
Operon arrangement:
Transcription unit        Promoter
insA4AB4B4


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gfcAp1 1049834 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1308 1049998 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1309 (cluster) 1050701 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Escoubas JM., Lane D., Chandler M., 1994, Is the IS1 transposase, InsAB', the only IS1-encoded protein required for efficient transposition?, J Bacteriol 176(18):5864-7

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB