RegulonDB RegulonDB 10.9: Gene Form
   

insCD2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD2 insD2 insC2 ynbG TSS_1792 TSS_1792 TSS_1791 TSS_1791

Gene      
Name: insCD2    Texpresso search in the literature
Synonym(s): G0-10542
Genome position(nucleotides): 1467921 <-- 1469149 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.19
External database links:  
ECOLIHUB:
insCD-2
COLOMBOS: insCD2


Product      
Name: IS2 element transposase InsAB'
Synonym(s): InsAB'
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 46.442
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
169 -> 212 GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL
232 -> 335 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4255
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insCD2C2D2         
Operon arrangement:
Transcription unit        Promoter
insC2D2CD2


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1791 1467640 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1792 1467869 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1793 (cluster) 1469178 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1794 1469343 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1795 1470141 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB