RegulonDB RegulonDB 10.9: Gene Form
   

insCD3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD3 insH6 insD3 yoeG insC3 yoeH TSS_2309 TSS_2309 TSS_2308 TSS_2308 TSS_2307 TSS_2307 insHp4 insHp4 insHp2 insHp2 TSS_2306 TSS_2306

Gene      
Name: insCD3    Texpresso search in the literature
Synonym(s): G0-10543
Genome position(nucleotides): 2068952 <-- 2070180 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.19
External database links:  
ECOLIHUB:
insCD-3
COLOMBOS: insCD3


Product      
Name: IS2 element transposase InsAB'
Synonym(s): InsAB'
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 46.442
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
169 -> 212 GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL
232 -> 335 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4256
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insCD3C3D3         
Operon arrangement:
Transcription unit        Promoter
insC3D3CD3


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2306 2067312 reverse nd [RS-EPT-CBR] [1]
  promoter insHp2 2067498 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2067511 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2307 2067918 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2308 2067920 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2309 2067984 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2310 (cluster) 2070209 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2311 2071472 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB