RegulonDB RegulonDB 10.9: Gene Form
   

insCD4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD4 insD4 ygeN pbl ygeK ygeO insC4 ygeI ygeL terminator terminator

Gene      
Name: insCD4    Texpresso search in the literature
Synonym(s): G0-10544
Genome position(nucleotides): 2996372 <-- 2997600 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.19
External database links:  
ECOLIHUB:
insCD-4
COLOMBOS: insCD4


Product      
Name: IS2 element transposase InsAB'
Synonym(s): InsAB'
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 46.442
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
169 -> 212 GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL
232 -> 335 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4257
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insCD4C4D4-ygeON         
Operon arrangement:
Transcription unit        Promoter
insC4D4CD4-ygeON


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3142 (cluster) 2997629 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB