RegulonDB RegulonDB 10.9: Gene Form
   

insH21 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oppA insH21 ychE oppA5\' Fur Lrp GcvB anti-terminator anti-anti-terminator terminator oppBp oppBp TSS_1659 TSS_1659 TSS_1658 TSS_1658 TSS_1657 TSS_1657 TSS_1656 TSS_1656 TSS_1655 TSS_1655 TSS_1654 TSS_1654 TSS_1653 TSS_1653 TSS_1652 (cluster) TSS_1652 (cluster) TSS_1651 TSS_1651 TSS_1650 TSS_1650 TSS_1649 TSS_1649 TSS_1648 TSS_1648 TSS_1647 (cluster) TSS_1647 (cluster) TSS_1646 TSS_1646 TSS_1645 (cluster) TSS_1645 (cluster) TSS_1644 TSS_1644 TSS_1643 TSS_1643 TSS_1642 TSS_1642 TSS_1641 TSS_1641 TSS_1640 (cluster) TSS_1640 (cluster) TSS_1639 (cluster) TSS_1639 (cluster) TSS_1638 (cluster) TSS_1638 (cluster) TSS_1637 (cluster) TSS_1637 (cluster) TSS_1636 (cluster) TSS_1636 (cluster) TSS_1635 (cluster) TSS_1635 (cluster) TSS_1634 TSS_1634 TSS_1633 TSS_1633 TSS_1632 TSS_1632 TSS_1631 (cluster) TSS_1631 (cluster) oppAp oppAp TSS_1630 (cluster) TSS_1630 (cluster) TSS_1629 TSS_1629 TSS_1628 (cluster) TSS_1628 (cluster) TSS_1627 TSS_1627 TSS_1626 (cluster) TSS_1626 (cluster) TSS_1625 TSS_1625 TSS_1624 (cluster) TSS_1624 (cluster) TSS_1623 TSS_1623 TSS_1622 (cluster) TSS_1622 (cluster)

Gene      
Name: insH21    Texpresso search in the literature
Synonym(s): ECK4568, G0-16639, b4711
Genome position(nucleotides): 1299567 --> 1300547 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
External database links:  
ASAP:
ABE-0285316
COLOMBOS: insH21


Product      
Name: IS5 transposase and trans-activator
Synonym(s): InsH21
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 37.851
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4347
INTERPRO:
IPR002559
INTERPRO:
IPR008490
PFAM:
PF01609
PFAM:
PF05598
UNIPROT:
A0A385XJE6


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1622 (cluster) 1299471 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1623 1300978 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1624 (cluster) 1301011 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1625 1301043 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1626 (cluster) 1301047 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1627 1301061 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1628 (cluster) 1301063 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1629 1301072 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1630 (cluster) 1301075 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1631 (cluster) 1301130 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1632 1301156 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1633 1301325 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1634 1301421 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1635 (cluster) 1301440 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1636 (cluster) 1301445 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1637 (cluster) 1301448 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1638 (cluster) 1301452 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1639 (cluster) 1301462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1640 (cluster) 1301471 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1641 1301475 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1642 1301479 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1643 1301484 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1644 1301505 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1645 (cluster) 1301513 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1646 1301585 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1647 (cluster) 1301592 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1648 1301596 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1649 1301629 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1650 1301632 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1651 1301651 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1652 (cluster) 1301927 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1653 1301955 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1654 1301979 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1655 1302037 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1656 1302088 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1657 1302221 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1658 1302237 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1659 1302457 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB