RegulonDB RegulonDB 10.8: Amino acid Sequence
RhsE protein in rhs element Amino Acid Sequence


Size: 682

Fasta

 

>RhsE protein in rhs element E. coli K12. Version NC_000913.3 GI:556503834
MSTRLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPETGELLWHHETGHAYNEQGLA
NRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLLEFTRDRLHRETVRSFGSMAGSNAAYKLT
STYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPD
LDIRIPYATDPAGNRLPDPELHPDSTLTVWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPA
GVIRTDDERTHHYHYDSQHRLVFYTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTG
WMSLSRKPEVTWYGWDGDRLTTVQTDTTRIQTVYEPGSFTPLIRVETENGEREKAQRRSL
AETLQQEGSENGHGVVFPAELVRLLDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVE
PEYTPARKVHFYHCDHRGLPLALISEDGNTAWRGEYDEWGNQLNEENPHHLHQPYRLPGQ
QHDEESGLYYNRHRHYDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMT
SGGLIYAVSGVPGLIAANSITNSAYQFGYDMDAIVGGAHNGAADAMRHCYLMCRMTKTFG
STIADVIGKNHEAAGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNTGQLFG
LDGIKADNPIKAKQGSSDASNY
              
                            

Download fasta file
RegulonDB