RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA binding and peroxide stress response protein YaaA Amino Acid Sequence


Size: 258

Fasta

 

>peroxide stress resistance protein YaaA E. coli K12. Version NC_000913.3 GI:556503834
MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQISTLMRISDKLAGIN
AARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLSGLYGVLRP
LDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQGDNVVINLASDEYFKSVK
PKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTKPEQLTGFNSEGYFF
DEDSSSNGELVFKRYEQR
              
                            

Download fasta file
RegulonDB