RegulonDB RegulonDB 10.10: Amino acid Sequence
1,6-anhydro-N-acetylmuramoyl-L-alanine amidase Amino Acid Sequence


Size: 183

Fasta

 

>1,6-anhydro-N-acetylmuramoyl-L-alanine amidase E. coli K12. Version NC_000913.3 GI:556503834
MLLEQGWLVGARRVPSPHYDCRPDDETPTLLVVHNISLPPGEFGGPWIDALFTGTIDPQA
HPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSQYQGRERCNDFSIGIELEGT
DTLAYTDAQYQQLAAVTRALIDCYPDIAKNMTGHCDIAPDRKTDPGPAFDWARFRVLVSK
ETT
              
                            

Download fasta file
RegulonDB