RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; DNA-binding transcriptional activator AppY Amino Acid Sequence


Size: 249

Fasta

 

>DNA-binding transcriptional activator AppY E. coli K12. Version NC_000913.3 GI:556503834
MDYVCSVVFICQSFDLIINRRVISFKKNSLFIVSDKIRRELPVCPSKLRIVDIDKKTCLS
FFIDVNNELPGKFTLDKNGYIAEEEPPLSLVFSLFEGIKIADSHSLWLKERLCISLLAMF
KKRESVNSFILTNINTFTCKITGIISFNIERQWHLKDIAELIYTSESLIKKRLRDEGTSF
TEILRDTRMRYAKKLITSNSYSINVVAQKCGYNSTSYFICAFKDYYGVTPSHYFEKIIGV
TDGINKTID
              
                            

Download fasta file
RegulonDB