RegulonDB RegulonDB 10.9: Amino acid Sequence
adenine phosphoribosyltransferase Amino Acid Sequence


Size: 183

Fasta

 

>adenine phosphoribosyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKV
VGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGD
KVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLVPF
PGH
              
                            

Download fasta file
RegulonDB