RegulonDB RegulonDB 10.9: Amino acid Sequence
aromatic amino acid:H+ symporter AroP Amino Acid Sequence


Size: 457

Fasta

 

>aromatic amino acid:H+ symporter AroP E. coli K12. Version NC_000913.3 GI:556503834
MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAF
LIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQF
WYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLFSGNG
GPQATVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQ
VIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVY
NSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFG
LLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWICLLFMAAVLVIM
LMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH
              
                            

Download fasta file
RegulonDB