RegulonDB RegulonDB 11.1: Amino acid Sequence
DNA-binding transcriptional repressor BetI Amino Acid Sequence


Size: 195

Fasta

 

>DNA-binding transcriptional repressor BetI E. coli K12. Version NC_000913.3 GI:556503834
MPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEAT
MRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDETQVSSAAMKAWLAFWASSMHQP
MLYRLQQVSSRRLLSNLVSEFRRELPREQAQEAGYGLAALIDGLWLRAALSGKPLDKTRA
NSLTRHFITQHLPTD
              
                            

Download fasta file
RegulonDB