RegulonDB RegulonDB 10.9: Amino acid Sequence
thioredoxin/glutathione peroxidase Amino Acid Sequence


Size: 183

Fasta

 

>thioredoxin/glutathione peroxidase E. coli K12. Version NC_000913.3 GI:556503834
MQDSILTTVVKDIDGEVTTLEKFAGNVLLIVNVASKCGLTPQYEQLENIQKAWVDRGFMV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVMESIKLA
LAK
              
                            

Download fasta file
RegulonDB