RegulonDB RegulonDB 11.1: Amino acid Sequence
cobinamide/cobalamin adenosyltransferase Amino Acid Sequence


Size: 196

Fasta

 

>cobinamide/cobalamin adenosyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSDERYQQRQQRVKEKVDARVAQAQDERGIIIVFTGNGKGKTTAAFGTATRAVGHGKKVG
VVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWDTQNRESDTAACREVWQHAKRMLADSS
LDMVLLDELTYMVAYDYLPLEEVVQALNERPHQQTVIITGRGCHRDILELADTVSELRPV
KHAFDAGVKAQIGIDY
              
                            

Download fasta file
RegulonDB