RegulonDB RegulonDB 10.9: Amino acid Sequence
CDP-diacylglycerol diphosphatase Amino Acid Sequence


Size: 251

Fasta

 

>CDP-diacylglycerol diphosphatase E. coli K12. Version NC_000913.3 GI:556503834
MKKAGLLFLVMIVIAVVAAGIGYWKLTGEESDTLRKIVLEECLPNQQQNQNPSPCAEVKP
NAGYVVLKDLNGPLQYLLMPTYRINGTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVP
DRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLANISSRWLPLPGGLRGHEYLAR
RVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLNRASAE
EIQDHQCEILR
              
                            

Download fasta file
RegulonDB