RegulonDB RegulonDB 10.9: Amino acid Sequence
N,N'-diacetylchitobiose-specific PTS enzyme IIB component Amino Acid Sequence


Size: 106

Fasta

 

>N,N'-diacetylchitobiose-specific PTS enzyme IIB component E. coli K12. Version NC_000913.3 GI:556503834
MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQI
AYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN
              
                            

Download fasta file
RegulonDB