RegulonDB RegulonDB 10.8: Amino acid Sequence
molybdopterin-synthase adenylyltransferase Amino Acid Sequence


Size: 249

Fasta

 

>molybdopterin-synthase adenylyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MAELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTL
LDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIA
EHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLF
GENALTCVEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMR
NPGCEVCGQ
              
                            

Download fasta file
RegulonDB