RegulonDB RegulonDB 10.9: Amino acid Sequence
colicin V production protein Amino Acid Sequence


Size: 162

Fasta

 

>colicin V production protein E. coli K12. Version NC_000913.3 GI:556503834
MVWIDYAIIAVIAFSSLVSLIRGFVREALSLVTWGCAFFVASHYYTYLSVWFTGFEDELV
RNGIAIAVLFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGVCFGALRGVLIVAAILFFL
DSFTGVSKSEDWSKSQLIPQFSFIIRCFFDYLQSSSSFLPRA
              
                            

Download fasta file
RegulonDB