RegulonDB RegulonDB 10.8: Amino acid Sequence
cyanate transporter Amino Acid Sequence


Size: 384

Fasta

 

>cyanate transporter E. coli K12. Version NC_000913.3 GI:556503834
MLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSVAALLTALPVVTMGGLALAGSWLHQ
HVSERRSVAISLLLIAVGALMRELYPQSALLLSSALLGGVGIGIIQAVMPSVIKRRFQQR
TPLVMGLWSAALMGGGGLGAAITPWLVQHSETWYQTLAWWALPAVVALFAWWWQSAREVA
SSHKTTTTPVRVVFTPRAWTLGVYFGLINGGYASLIAWLPAFYIEIGASAQYSGSLLALM
TLGQAAGALLMPAMARHQDRRKLLMLALVLQLVGFCGFIWLPMQLPVLWAMVCGLGLGGA
FPLCLLLALDHSVQPAIAGKLVAFMQGIGFIIAGLAPWFSGVLRSISGNYLMDWAFHALC
VVGLMIITLRFAPVRFPQLWVKEA
              
                            

Download fasta file
RegulonDB